PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 561aa    MW: 61300.2 Da    PI: 7.0225
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018061genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.83.1e-10405463563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l++++
  Lus10018061 405 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSLGLTNQN 463
                  9*********************************************9998888777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-18401465IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.726403466IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.52E-11405456No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-10405460No hitNo description
PfamPF001701.3E-8405456IPR004827Basic-leucine zipper domain
CDDcd147034.21E-24406455No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MGDTEEGSTD VMQRLQSSFG TNQSSSSSMP KQMPFSSSPR QLDISPLSQN QMRAKHFAHF  60
AQQQGFSGAG DSISNNKRAG IPPSHPNQIP PISPFSQIPV SRPVNHQIGS QSFSTTNKPG  120
HSRSLSQPSS FFSLDSLPPL SPASFRDHSP TSEQVPTDAS MEVDRDGNSH SVLPPSPYSR  180
SSSIAPRVGE SLPPRKAHRR SNSDIPFGFS TVMQSSPPLK FGNKPAQVVK NEEGMGERKS  240
EGEAMDDLFS AYMNLDNFDS LNSSGTDDKN GNENREDLDS RASGTKTNGG DSSDNEAESS  300
INESGSSFPR REGTKRSAEG DIAPTPRHHR SVSLDSFMGK LNFGGDESPK LPPSPGPRPG  360
QLSPTSSIDG SAFSLDFGNG EFNSVELKKI MANEKLTEIA LTDPKRAKRI LANRQSAARS  420
KERKMRYISE LEHKVQTLQT EATTLSAQLT LLQRDSLGLT NQNNELKFRL QAMEQQAQLR  480
DALNEALTAE VRRLKIATAE ISENSADPSK GTNQQHQDCA NSQMFQQQQQ QQMSSQRNMN  540
QLQQQHEQRN GTNSKPEANQ *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012084427.10.0PREDICTED: transcription factor RF2a-like
TrEMBLA0A067K7430.0A0A067K743_JATCU; Uncharacterized protein
STRINGPOPTR_0004s17080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22723484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-121bZIP family protein